Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P02778 |
| Uniprot Entry Name | |
| Gene Names | CXCL10 |
| Alternative Names | C-X-C Motif Chemokine 10; 10 kDa Interferon Gamma-Induced Protein; Gamma-IP10; IP-10; Small-Inducible Cytokine B10; CXCL10; INP10; SCYB10 |
| Expression Region | Full Length of Mature Protein (22-98aa) |
| Molecular Weight | 8.6 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0) |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Human C-X-C Motif Chemokine Ligand 10 (CXCL10) is a non-ELR chemokine secreted by various cell types, such as monocytes, endothelial cells and fibroblasts, in response to IFN-γ. CXCL10 functions via chemokine receptor CXCR3. CXCL10 has been attributed to several roles, such as chemoattraction for activated T-lymphocytes, inhibition of angiogenesis, and antitumor activity. |
| Function | Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. |
| Involvement in disease | |
| Subcellular Location | Secreted |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Tissue Specificity | |
| Pathway | Chemokinesignalingpathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |