Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P25025 |
| Gene Names | CXCR2 |
| Alternative Names | CDw128b GRO/MGSA receptor High affinity interleukin-8 receptor B Short name: IL-8R B IL-8 receptor type 2 CD_antigen: CD182 |
| Expression Region | Partial(1-40aa ) |
| Molecular Weight | 20.6 kDa |
| Protein Sequence | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 1 family |
| Tissue Specificity | CXCR2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |