Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprot ID | Q8WTT0 |
| Uniprot Entry Name | |
| Gene Names | CLEC4C |
| Alternative Names | Blood dendritic cell antigen 2 ;BDCA-2;C-type lectin superfamily member 7Dendritic lectin; CD303 |
| Expression Region | Extracellular Domain (45-213aa) |
| Molecular Weight | 36 kDa |
| Endotoxin | Not test. |
| Sequence | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
| Product Form | Lyophilized powder (Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose. |
| Function | |
| Involvement in disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |