Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P13501 |
| Gene Names | CCL5 |
| Alternative Names | EoCPEosinophil chemotactic cytokine;SIS-delta;Small-inducible cytokine A5T cell-specific protein P228 ;TCP228T-cell-specific protein RANTES |
| Expression Region | Full Length of Mature Protein(24-91aa ) |
| Molecular Weight | 11.9 kDa |
| Protein Sequence | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Intercrine beta (chemokine CC) family |
| Tissue Specificity | CCL5 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |