Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P10147 |
| Uniprot Entry Name | |
| Gene Names | CCL3 |
| Alternative Names | C-C Motif Chemokine 3; G0/G1 Switch Regulatory Protein 19-1; Macrophage Inflammatory Protein 1-Alpha; MIP-1-Alpha; PAT 464.1; SIS-Beta; Small-Inducible Cytokine A3; Tonsillar Lymphocyte LD78 Alpha Protein; CCL3; G0S19-1; MIP1A; SCYA3 |
| Expression Region | Full Length of Mature Protein (24-92aa) |
| Molecular Weight | 7.5 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4) |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Human Chemokine (C-C Motif) Ligand 3 (CCL3) is a small cytokine belonging to the CC chemokine family. CCL3 is primarily expressed in T cells, B cells, and monocytes after antigen or mitogen stimulation. CCL3 exhibits chemoattractive and adhesive effects on lymphocytes. CCL3 exerts multiple effects on hematopoietic precursor cells and inhibits the proliferation of hematopoietic stem cells in vitro as well as in vivo. CCR1 and CCR5 have been identified as functional receptors for CCL3. |
| Function | Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). |
| Involvement in disease | |
| Subcellular Location | Secreted |
| Protein Families | Intercrine beta (chemokine CC) family |
| Tissue Specificity | |
| Pathway | Chemokinesignalingpathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |