Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O00175 |
| Gene Names | CCL24 |
| Alternative Names | CK-beta-6Eosinophil chemotactic protein 2Eotaxin-2Myeloid progenitor inhibitory factor 2 ;MPIF-2Small-inducible cytokine A24 |
| Expression Region | Full Length of Mature Protein(27-119aa ) |
| Molecular Weight | 14.5 kDa |
| Protein Sequence | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Chotactic for resting T-lymphocytes, and eosinophils. Has lower chotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hatopoietic progenitor cell line. Binds to CCR3. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Intercrine beta (chemokine CC) family |
| Tissue Specificity | CCL24 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |