Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O00626 |
| Gene Names | CCL22 |
| Alternative Names | CC chemokine STCP-1MDC(1-69)Macrophage-derived chemokine;Small-inducible cytokine A22Stimulated T-cell chemotactic protein 1 |
| Expression Region | Partial(25-82aa ) |
| Molecular Weight | 33.7 kDa |
| Protein Sequence | GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chotactic for monocytes, dendritic cells and natural killer cells. Mild choattractant for primary activated T-lymphocytes and a potent choattractant for chronically activated T-lymphocytes but has no choattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC(3-69), MDC(5-69) and MDC(7-69) se not be active. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Intercrine beta (chemokine CC) family |
| Tissue Specificity | CCL22 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |