Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q99731 |
| Gene Names | CCL19 |
| Alternative Names | Beta-chemokine exodus-3CK beta-11Epstein-Barr virus-induced molecule 1 ligand chemokine ;EBI1 ligand chemokine ;ELCMacrophage inflammatory protein 3 beta ;MIP-3-beta;Small-inducible cytokine A19 |
| Expression Region | Full Length of Mature Protein(22-98aa ) |
| Molecular Weight | 35.8 kDa |
| Protein Sequence | GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chokine receptor CCR7. Recombinant CCL19 shows potent chotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Intercrine beta (chemokine CC) family |
| Tissue Specificity | CCL19 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |