Specification
| Gene Names | CCR9 |
| Alternative Names | C-C CKR-9; CC-CKR-9; CCR-9;G-protein coupled receptor 28;GPR-9-6 |
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Molecular Weight | 43.4 kDa |
| Expression Region | Full Length(1-369aa ) |
| Expression Region | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)(Full Length ) |
| Purity | Greater than 95% as determined by SEC-HPLC. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Biological Activity | Measured by its binding ability in a functional ELISA. The EC50 is 31.67-36.83 ng/mL. |
| Form | Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
| Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
| Protein Sequence | MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL |
Background
| Research Areas | Immunology |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |