Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | C-terminal 6xHis-Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P51685 |
| Gene Names | CCR8 |
| Alternative Names | C-C chemokine receptor type 8(C-C CKR-8)(CC-CKR-8)(CCR-8)(CC chemokine receptor CHEMR1)(CMKBRL2)(Chemokine receptor-like 1)(CKR-L1)(GPR-CY6)(GPRCY6)(TER1)(CD antigen CDw198) |
| Expression Region | Partial(1-35aa ) |
| Molecular Weight | 7.7 kDa |
| Protein Sequence | MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | CCR8 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
