Recombinant Human C-C chemokine receptor type 8(CCR8),partial

Specification
Organism Homo sapiens (Human)
Expression Host Yeast
Tag Info C-terminal 6xHis-Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P51685
Gene Names CCR8
Alternative Names C-C chemokine receptor type 8(C-C CKR-8)(CC-CKR-8)(CCR-8)(CC chemokine receptor CHEMR1)(CMKBRL2)(Chemokine receptor-like 1)(CKR-L1)(GPR-CY6)(GPRCY6)(TER1)(CD antigen CDw198)
Expression Region Partial(1-35aa )
Molecular Weight 7.7 kDa
Protein Sequence MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity CCR8
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$331.00
In stock
SKU
EB-PYHU148596

Recombinant Human C-C chemokine receptor type 8(CCR8),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human C-C chemokine receptor type 8(CCR8),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.