Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Protein Tag | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% as determined by SDS-PAGE. |
Endotoxin Level | Not test. |
Biological Activity | |
Uniprot ID | P32246 |
Gene Names | CCR1 |
Alternative Names | (C-C CKR-1)(CC-CKR-1)(CCR-1)(CCR1)(HM145)(LD78 receptor)(Macrophage inflammatory protein 1-alpha receptor)(MIP-1alpha-R)(RANTES-R)(CD antigen CD191) |
Expression Region | 306-355aa |
Product Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.662 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-776℃. |
Protein Length | Partial |
Molecular Weight | 18.9 kDa |
Protein Sequence | ERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF |
Background
Research Areas | Immunology |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |