Recombinant Human BTG4 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens BTG anti-proliferation factor 4 (BTG4), transcript variant 1 (NM_017589).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9NY30
Entry Name BTG4_HUMAN
Gene Names BTG4 PC3B
Alternative Gene Names PC3B
Alternative Protein Names Protein BTG4 (BTG family member 4) (Protein PC3b)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 223
Molecular Weight(Da) 25970
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQVENLKQPFQSWLQIPRKKNVVDGRVGLLGNTYHGSQKHPKCYRPAMHRLDRIL
Background
Function FUNCTION: Adapter protein that bridges CNOT7, a catalytic subunit of the CCR4-NOT complex, to EIF4E (By similarity). Facilitates maternal mRNAs decay during the maturation of oocytes and in the fertilized egg, and is required for the maternal-zygotic transition (MZT), zygotic cleavage and initiation of embryonic development (PubMed:32502391). {ECO:0000250|UniProtKB:O70552, ECO:0000269|PubMed:32502391}.
Pathway
Protein Families BTG family
Tissue Specificity Expressed in oocytes after germinal vesicle breakdown (PubMed:32502391). Expressed in testis and in olfactory epithelium. {ECO:0000269|PubMed:32502391}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8012545

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human BTG4 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.