Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens BRICK1 subunit of SCAR/WAVE actin nucleating complex (BRK1) (NM_018462). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8WUW1 |
| Entry Name | BRK1_HUMAN |
| Gene Names | BRK1 C3orf10 HSPC300 MDS027 |
| Alternative Gene Names | C3orf10 |
| Alternative Protein Names | Protein BRICK1 (BRK1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 75 |
| Molecular Weight(Da) | 8745 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT |
Background
| Function | FUNCTION: Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity). {ECO:0000250|UniProtKB:Q91VR8, ECO:0000269|PubMed:18560548}. |
| Pathway | |
| Protein Families | BRK1 family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |