Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P23560 |
| Gene Names | BDNF |
| Alternative Names | Abrineurin |
| Expression Region | Full Length of Mature Protein(129-247aa ) |
| Molecular Weight | 29.5 kDa |
| Protein Sequence | HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systs. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is phasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. |
| Involvement in Disease | Bulimia nervosa 2 (BULN2); Congenital central hypoventilation syndrome (CCHS) |
| Subcellular Location | Secreted |
| Protein Families | NGF-beta family |
| Tissue Specificity | BDNF |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
