Recombinant Human BPI fold-containing family A member 2(BPIFA2)

Specification
Organism Homo sapiens (Human)
Expression Host in vitro E.coli expression system
Tag Info Tag-Free
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q96DR5
Gene Names BPIFA2
Alternative Names Parotid secretory protein
Expression Region Full Length of Mature Protein(19-249aa )
Molecular Weight 25.1 kDa
Protein Sequence ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Has strong antibacterial activity against P. aeruginosa.
Involvement in Disease
Subcellular Location Secreted
Protein Families BPI/LBP/Plunc superfamily, Plunc family
Tissue Specificity BPIFA2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$904.00
In stock
SKU
EB-PC8HU839433

Recombinant Human BPI fold-containing family A member 2(BPIFA2)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human BPI fold-containing family A member 2(BPIFA2)
Copyright © 2021-present Echo Biosystems. All rights reserved.