Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P36894 |
| Gene Names | BMPR1A |
| Alternative Names | Activin receptor-like kinase 3 ;ALK-3Serine/threonine-protein kinase receptor R5 ;SKR5; CD292 |
| Expression Region | Cytoplasmic Domain(177-532aa ) |
| Molecular Weight | 56.6 kDa |
| Protein Sequence | KHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | On ligand binding, forms a receptor complex consisting of two type II and two type I transmbrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP-2 and BMP-4. Positively regulates chondrocyte differentiation through GDF5 interaction . |
| Involvement in Disease | Juvenile polyposis syndrome (JPS); Polyposis syndrome, mixed hereditary 2 (HMPS2) |
| Subcellular Location | Membrane, Single-pass type I membrane protein |
| Protein Families | Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily |
| Tissue Specificity | BMPR1A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |