Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P12644 |
| Gene Names | BMP4 |
| Alternative Names | Bone morphogenetic protein 2B ;BMP-2B |
| Expression Region | Full Length of Mature Protein(293-408aa ) |
| Molecular Weight | 29.1 kDa |
| Protein Sequence | SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during bryonic mammary development and to inhibit hair follicle induction . |
| Involvement in Disease | Microphthalmia, syndromic, 6 (MCOPS6); Non-syndromic orofacial cleft 11 (OFC11) |
| Subcellular Location | Secreted, extracellular space, extracellular matrix |
| Protein Families | TGF-beta family |
| Tissue Specificity | BMP4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |