Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens bolA family member 3 (BOLA3), transcript variant 2 (NM_001035505). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q53S33 |
| Entry Name | BOLA3_HUMAN |
| Gene Names | BOLA3 |
| Alternative Gene Names | |
| Alternative Protein Names | BolA-like protein 3 |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 107 |
| Molecular Weight(Da) | 12114 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVPKR |
Background
| Function | FUNCTION: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with NFU1 (PubMed:27532772). {ECO:0000250|UniProtKB:P39724, ECO:0000305|PubMed:27532772}. |
| Pathway | |
| Protein Families | BolA/IbaG family |
| Tissue Specificity | Widely expressed. {ECO:0000269|PubMed:18548201}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |