Specification
Organism | Homo sapiens (Human) |
Expression Host | Mammalian cell |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q02161 |
Gene Names | RHD |
Alternative Names | RHXIII Rh polypeptide 2 Short name: RhPII Rhesus D antigen CD_antigen: CD240D |
Expression Region | Partial(388-417aa ) |
Molecular Weight | 29.6 kDa |
Protein Sequence | LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. |
Involvement in Disease | |
Subcellular Location | Membrane, Multi-pass membrane protein |
Protein Families | Ammonium transporter (TC 2.A.49) family, Rh subfamily |
Tissue Specificity | RHD |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |