Recombinant Human Blood group Rh(D) polypeptide(RHD),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q02161
Gene Names RHD
Alternative Names RHXIII Rh polypeptide 2 Short name: RhPII Rhesus D antigen CD_antigen: CD240D
Expression Region Partial(388-417aa )
Molecular Weight 33.6 kDa
Protein Sequence LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Involvement in Disease
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Ammonium transporter (TC 2.A.49) family, Rh subfamily
Tissue Specificity RHD
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE7HU19802

Recombinant Human Blood group Rh(D) polypeptide(RHD),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Blood group Rh(D) polypeptide(RHD),partial
Copyright © 2026-present Echo Bio. All rights reserved.