Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P43251 |
| Gene Names | BTD |
| Alternative Names | (Biotinase) |
| Expression Region | 322-397aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.77 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-169℃. |
| Protein Length | Partial |
| Molecular Weight | 41.3 kDa |
| Protein Sequence | YHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSE |
Background
| Research Areas | Metabolism |
| Relevance | Catalytic release of biotin from biocytin, the product of biotin-dependent carboxylases degradation. |
| Function | |
| Reference | "Partial biotinidase deficiency is usually due to the D444H mutation in the biotinidase gene." Swango K.L., Demirkol M., Huener G., Pronicka E., Sykut-Cegielska J., Schulze A., Mayatepek E., Wolf B. Hum. Genet. 102:571-575(1998) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |