Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P21810 |
| Gene Names | BGN |
| Alternative Names | Bone/cartilage proteoglycan I PG-S1 |
| Expression Region | Full Length of Mature Protein(38-368aa ) |
| Molecular Weight | 57.2 kDa |
| Protein Sequence | DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May be involved in collagen fiber assembly. |
| Involvement in Disease | Meester-Loeys syndrome (MRLS); Spondyloepimetaphyseal dysplasia, X-linked (SEMDX) |
| Subcellular Location | Secreted, extracellular space, extracellular matrix |
| Protein Families | Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily |
| Tissue Specificity | BGN |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |