Recombinant Human BID protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens BH3 interacting domain death agonist (BID), transcript variant 1 (NM_197966).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P55957
Entry Name BID_HUMAN
Gene Names BID
Alternative Gene Names
Alternative Protein Names BH3-interacting domain death agonist (p22 BID) (BID) [Cleaved into: BH3-interacting domain death agonist p15 (p15 BID); BH3-interacting domain death agonist p13 (p13 BID); BH3-interacting domain death agonist p11 (p11 BID)]
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 195
Molecular Weight(Da) 21995
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Background
Function FUNCTION: Induces caspases and apoptosis (PubMed:14583606). Counters the protective effect of BCL2 (By similarity). {ECO:0000250|UniProtKB:P70444, ECO:0000269|PubMed:14583606}.; FUNCTION: [BH3-interacting domain death agonist p15]: Induces caspase activation and apoptosis (PubMed:15661737). Allows the release of cytochrome c (By similarity). {ECO:0000250|UniProtKB:P70444, ECO:0000269|PubMed:15661737}.; FUNCTION: [Isoform 1]: Induces ICE-like proteases and apoptosis. {ECO:0000269|PubMed:14583606}.; FUNCTION: [Isoform 2]: Induces ICE-like proteases and apoptosis. {ECO:0000269|PubMed:14583606}.; FUNCTION: [Isoform 3]: Does not induce apoptosis. {ECO:0000269|PubMed:14583606}.; FUNCTION: [Isoform 4]: Induces ICE-like proteases and apoptosis. {ECO:0000269|PubMed:14583606}.
Pathway
Protein Families
Tissue Specificity [Isoform 2]: Expressed in spleen, pancreas and placenta (at protein level). {ECO:0000269|PubMed:14583606}.; TISSUE SPECIFICITY: [Isoform 3]: Expressed in lung, pancreas and spleen (at protein level). {ECO:0000269|PubMed:14583606}.; TISSUE SPECIFICITY: [Isoform 4]: Expressed in lung and pancreas (at protein level). {ECO:0000269|PubMed:14583606}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8637416

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human BID protein
Copyright © 2021-present Echo Biosystems. All rights reserved.