Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P55957 |
| Gene Names | BID |
| Alternative Names | p22 BID ;BID |
| Expression Region | Full Length(1-195aa ) |
| Molecular Weight | 38 kDa |
| Protein Sequence | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | The major proteolytic product p15 BID allows the release of cytochrome c . Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2.1 Publication |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, Mitochondrion membrane, Note=When uncleaved, it is predominantly cytoplasmic, SUBCELLULAR LOCATION: BH3-interacting domain death agonist p15: Mitochondrion membrane, Note=Translocates to mitochondria as an integral membrane protein, SUBCELLULAR LOCATION: BH3-interacting domain death agonist p13: Mitochondrion membrane, Note=Associated with the mitochondrial membrane, SUBCELLULAR LOCATION: Isoform 1: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 2: Mitochondrion membrane |
| Protein Families | |
| Tissue Specificity | BID |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |