Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens brain expressed X-linked 1 (BEX1) (NM_018476). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9HBH7 |
| Entry Name | BEX1_HUMAN |
| Gene Names | BEX1 |
| Alternative Gene Names | |
| Alternative Protein Names | Protein BEX1 (Brain-expressed X-linked protein 1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 125 |
| Molecular Weight(Da) | 14860 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP |
Background
| Function | FUNCTION: Signaling adapter molecule involved in p75NTR/NGFR signaling. Plays a role in cell cycle progression and neuronal differentiation. Inhibits neuronal differentiation in response to nerve growth factor (NGF). May act as a link between the cell cycle and neurotrophic factor signaling, possibly by functioning as an upstream modulator of receptor signaling, coordinating biological responses to external signals with internal cellular states (By similarity). {ECO:0000250}. |
| Pathway | |
| Protein Families | BEX family |
| Tissue Specificity | Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Expressed in lung, skeletal muscle, peripheral blood leukocyte, stomach, lymph node, trachea and bone marrow. Highly expressed in acute myeloid leukemia. {ECO:0000269|PubMed:11989783, ECO:0000269|PubMed:15920485, ECO:0000269|PubMed:15958283}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
