Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1(ST6GAL1)

Specification
Organism Homo sapiens (Human)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P15907
Gene Names ST6GAL1
Alternative Names B-cell antigen CD75 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1 ST6Gal I
Expression Region Full Length(1-406aa )
Molecular Weight 52.1 kDa
Protein Sequence MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Transfers sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.
Involvement in Disease
Subcellular Location Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein, Secreted
Protein Families Glycosyltransferase 29 family
Tissue Specificity ST6GAL1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$1,991.00
In stock
SKU
EB-PC9HU22884

Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1(ST6GAL1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1(ST6GAL1)
Copyright © 2021-present Echo Biosystems. All rights reserved.