Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P08588 |
| Gene Names | ADRB1 |
| Alternative Names | Beta-1 adrenoreceptor Short name: Beta-1 adrenoceptor |
| Expression Region | Cytoplasmic Domain(378-477aa ) |
| Molecular Weight | 12.5 kDa |
| Protein Sequence | CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Multi-pass membrane protein, Early endosome |
| Protein Families | G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily |
| Tissue Specificity | ADRB1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |