Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens brain derived neurotrophic factor (BDNF), transcript variant 2 (NM_170732). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P23560 |
| Entry Name | BDNF_HUMAN |
| Gene Names | BDNF |
| Alternative Gene Names | |
| Alternative Protein Names | Brain-derived neurotrophic factor (BDNF) (Abrineurin) [Cleaved into: BDNF precursor form (ProBDNF)] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 247 |
| Molecular Weight(Da) | 27818 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Background
| Function | FUNCTION: Important signaling molecule that activates signaling cascades downstream of NTRK2 (PubMed:11152678). During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. {ECO:0000269|PubMed:11152678, ECO:0000269|PubMed:12553913, ECO:0000269|PubMed:29909994}.; FUNCTION: [BDNF precursor form]: Important signaling molecule that activates signaling cascades downstream of NTRK2. Activates signaling cascades via the heterodimeric receptor formed by NGFR and SORCS2 (PubMed:24908487, PubMed:29909994). Signaling via NGFR and SORCS2 plays a role in synaptic plasticity and long-term depression (LTD). Binding to NGFR and SORCS2 promotes neuronal apoptosis. Promotes neuronal growth cone collapse (By similarity). {ECO:0000250|UniProtKB:P21237, ECO:0000269|PubMed:24908487, ECO:0000269|PubMed:29909994}. |
| Pathway | |
| Protein Families | NGF-beta family |
| Tissue Specificity | Detected in blood plasma and in saliva (at protein level) (PubMed:11152678, PubMed:19467646). Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta. {ECO:0000269|PubMed:11152678, ECO:0000269|PubMed:17629449, ECO:0000269|PubMed:19467646, ECO:0000269|PubMed:2236018}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
