Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9BPU9 |
| Gene Names | B9D2 |
| Alternative Names | MKS1-related protein 2 |
| Expression Region | Full Length(1-175aa ) |
| Molecular Weight | 46.3 kDa |
| Protein Sequence | MAEVHVIGQIIGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. |
| Involvement in Disease | Meckel syndrome 10 (MKS10) |
| Subcellular Location | Cytoplasm, cytoskeleton, cilium basal body, Cytoplasm, cytoskeleton, cilium axoneme, Nucleus |
| Protein Families | B9D family |
| Tissue Specificity | B9D2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |