Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q86Y30 |
| Gene Names | BAGE2 |
| Alternative Names | Cancer/testis antigen 2.2 |
| Expression Region | Full Length of Mature Protein(18-109aa ) |
| Molecular Weight | 17.9 kDa |
| Protein Sequence | RLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEPTAFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Unknown. Candidate gene encoding tumor antigens. Miscellaneous The ancestral BAGE gene was generated by juxtacentromeric reshuffling of the KMT2C/MLL3 gene. The BAGE family was expanded by juxtacentromeric movement and/or acrocentric exchanges. BAGE family is composed of expressed genes that map to the juxtacentromeric regions of chromosomes 13 and 21 and of unexpressed gene fragments that scattered in the juxtacentromeric regions of several chromosomes, including chromosomes 9, 13, 18 and 21. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | BAGE2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
