Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q9Y5Q5 |
| Gene Names | CORIN |
| Alternative Names | (Corin)(Heart-specific serine proteinase ATC2)(Pro-ANP-converting enzyme)(Transmembrane protease serine 10) |
| Expression Region | 1-110aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.62 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-154℃. |
| Protein Length | Partial |
| Molecular Weight | 16.0 kDa |
| Protein Sequence | MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS |
Background
| Research Areas | Cardiovascular |
| Relevance | Serine-type endopeptidase involved in atrial natriuretic peptide (NPPA) and brain natriuretic peptide (NPPB) processing . Converts through proteolytic cleavage the non-functional propeptides NPPA and NPPB into their active hormones, ANP and BNP(1-32) respectively, thereby regulating blood pressure in the heart and promoting natriuresis, diuresis and vasodilation . Proteolytic cleavage of pro-NPPA also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus . Also acts as a regulator of sodium reabsorption in kidney.; [Isoform 2]: has weaker endopeptidase activity compared to isoform 1. |
| Function | |
| Reference | "Role of corin in trophoblast invasion and uterine spiral artery remodelling in pregnancy." Cui Y., Wang W., Dong N., Lou J., Srinivasan D.K., Cheng W., Huang X., Liu M., Fang C., Peng J., Chen S., Wu S., Liu Z., Dong L., Zhou Y., Wu Q. Nature 484:246-250(2012) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |