Recombinant Human ATP6V1G3 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens ATPase H+ transporting V1 subunit G3 (ATP6V1G3), transcript variant 1 (NM_133262).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96LB4
Entry Name VATG3_HUMAN
Gene Names ATP6V1G3 ATP6G3
Alternative Gene Names ATP6G3
Alternative Protein Names V-type proton ATPase subunit G 3 (V-ATPase subunit G 3) (V-ATPase 13 kDa subunit 3) (Vacuolar proton pump subunit G 3)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 118
Molecular Weight(Da) 13917
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
Background
Function FUNCTION: Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Pathway
Protein Families V-ATPase G subunit family
Tissue Specificity Kidney. {ECO:0000269|PubMed:12384298}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8394186

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human ATP6V1G3 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.