Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens ATPase H+ transporting V1 subunit G3 (ATP6V1G3), transcript variant 1 (NM_133262). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q96LB4 |
| Entry Name | VATG3_HUMAN |
| Gene Names | ATP6V1G3 ATP6G3 |
| Alternative Gene Names | ATP6G3 |
| Alternative Protein Names | V-type proton ATPase subunit G 3 (V-ATPase subunit G 3) (V-ATPase 13 kDa subunit 3) (Vacuolar proton pump subunit G 3) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 118 |
| Molecular Weight(Da) | 13917 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN |
Background
| Function | FUNCTION: Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. |
| Pathway | |
| Protein Families | V-ATPase G subunit family |
| Tissue Specificity | Kidney. {ECO:0000269|PubMed:12384298}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |