Recombinant Human ATP23 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens ATP23 metallopeptidase and ATP synthase assembly factor homolog (ATP23), transcript variant 1 (NM_033276).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9Y6H3
Entry Name ATP23_HUMAN
Gene Names ATP23 KUB3 XRCC6BP1
Alternative Gene Names KUB3 XRCC6BP1
Alternative Protein Names Mitochondrial inner membrane protease ATP23 homolog (EC 3.4.24.-) (Ku70-binding protein 3) (XRCC6-binding protein 1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 246
Molecular Weight(Da) 28081
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI
Background
Function
Pathway
Protein Families Peptidase M76 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8457625

Recombinant Human ATP23 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human ATP23 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.