Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P18859 |
| Gene Names | ATP5J |
| Alternative Names | ATP synthase; H+ transporting; mitochondrial F0 complex; subunit F6; ATP synthase-coupling factor 6; mitochondrial; ATP synthase-coupling factor 6; mitochondrial; ATP5; ATP5A; ATP5J; ATP5J_HUMAN; ATPase subunit F6; ATPM; CF6; F6 |
| Expression Region | Full Length(1-108aa ) |
| Molecular Weight | 36 kDa |
| Protein Sequence | NKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements. Also involved in the restoration of oligomycin-sensitive ATPase activity to depleted F1-F0 complexes. |
| Involvement in Disease | |
| Subcellular Location | Mitochondrion, Mitochondrion inner membrane |
| Protein Families | Eukaryotic ATPase subunit F6 family |
| Tissue Specificity | ATP5J |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |