Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P78508 |
| Gene Names | KCNJ10 |
| Alternative Names | ATP-dependent inwardly rectifying potassium channel Kir4.1Inward rectifier K(+) channel Kir1.2;Potassium channel, inwardly rectifying subfamily J member 10 |
| Expression Region | Cytoplasmic Domain(165-379aa ) |
| Molecular Weight | 39.8 kDa |
| Protein Sequence | FLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of Extracellular domain potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by Extracellular domain barium and cesium . |
| Involvement in Disease | Seizures, sensorineural deafness, ataxia, mental retardation, and electrolyte imbalance (SESAMES) |
| Subcellular Location | Membrane, Multi-pass membrane protein, Basolateral cell membrane |
| Protein Families | Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ10 subfamily |
| Tissue Specificity | KCNJ10 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |