Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P48048 |
| Gene Names | KCNJ1 |
| Alternative Names | ATP-regulated potassium channel ROM-KInward rectifier K(+) channel Kir1.1;Potassium channel, inwardly rectifying subfamily J member 1 |
| Expression Region | Cytoplasmic Domain(178-391aa ) |
| Molecular Weight | 26.3 kDa |
| Protein Sequence | ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of Extracellular domain potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium. |
| Involvement in Disease | Bartter syndrome 2, antenatal (BARTS2) |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ1 subfamily |
| Tissue Specificity | KCNJ1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
