Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P08183 |
| Gene Names | ABCB1 |
| Alternative Names | ATP-binding cassette sub-family B member 1;P-glycoprotein 1; CD243 |
| Expression Region | Partial(236-297aa ) |
| Molecular Weight | 10.8 kDa |
| Protein Sequence | LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells. |
| Involvement in Disease | Inflammatory bowel disease 13 (IBD13) |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily |
| Tissue Specificity | ABCB1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |