Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q12797 |
| Gene Names | ASPH |
| Alternative Names | Aspartate beta-hydroxylase ;ASP beta-hydroxylase;Peptide-aspartate beta-dioxygenase |
| Expression Region | Partial of Isoform 6 (75-270aa ) |
| Molecular Weight | 38.2 kDa |
| Protein Sequence | FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal growth factor-like (EGF) domains of a number of proteins. |
| Involvement in Disease | Facial dysmorphism, lens dislocation, anterior segment abnormalities, and spontaneous filtering blebs (FDLAB) |
| Subcellular Location | Isoform 1: Endoplasmic reticulum membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 4: Sarcoplasmic reticulum membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 8: Endoplasmic reticulum membrane, Single-pass type II membrane protein |
| Protein Families | Aspartyl/asparaginyl beta-hydroxylase family |
| Tissue Specificity | ASPH |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |