Recombinant Human ARL11 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens ADP ribosylation factor like GTPase 11 (ARL11) (NM_138450).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q969Q4
Entry Name ARL11_HUMAN
Gene Names ARL11 ARLTS1
Alternative Gene Names ARLTS1
Alternative Protein Names ADP-ribosylation factor-like protein 11 (ADP-ribosylation factor-like tumor suppressor protein 1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 196
Molecular Weight(Da) 21391
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS
Background
Function FUNCTION: May play a role in apoptosis. May act as a tumor suppressor. {ECO:0000269|PubMed:15843669}.
Pathway
Protein Families Small GTPase superfamily, Arf family
Tissue Specificity Expressed in lung and leukocytes. {ECO:0000269|PubMed:15843669}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8064255

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human ARL11 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.