Recombinant Human Arginase-1(ARG1) (Active)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info C-terminal 6xHis-tagged
Purity Greater than 95% as determined by SDS-PAGE.
Uniprot ID P05089
Uniprot Entry Name
Gene Names ARG1
Alternative Names Arginase-1; Liver-type arginase;Type I arginase;ARG1
Expression Region Full Length (1-322aa)
Molecular Weight 35.8 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Product Form Liquid (0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, 1 mM DTT, pH 7.4)
Reconstitution
Background
Relevance ARG1 is a member of the ureohydrolase family of enzymes. ARG1 can catalyze the hydrolysis of arginine to ornithine and urea. In the urea cycle, ARG1 catalyzes the fifth and final step, a series of biochemical reactions in mammals during which the body disposes of harmful ammonia. ARG1 is a cytosolic enzyme and expressed widely in the liver as part of the urea cycle. Inherited deficiency of this ARG1 causes argininemia, which is an autosomal recessive disorder characterized by hyperammonemia.
Function Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.
Involvement in disease Argininemia (ARGIN)
Subcellular Location Cytoplasm, Cytoplasmic granule
Protein Families Arginase family
Tissue Specificity Within the immune system initially reported to be selectively expressed in granulocytes (polymorphonuclear leukocytes [PMNs]) (PubMed:15546957). Also detected in macrophages mycobacterial granulomas (PubMed:23749634). Expressed in group2 innate lymphoid cells (ILC2s) during lung disease (PubMed:27043409).
Pathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$261.00
In stock
SKU
EB-CAPHU5686

Recombinant Human Arginase-1(ARG1) (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Arginase-1(ARG1) (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.