Recombinant Human Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)

Specification
Organism Homo sapiens (Human)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P20292
Gene Names ALOX5AP
Alternative Names FLAP MK-886-binding protein
Expression Region Full Length(1-161aa )
Molecular Weight 34.2 kDa
Protein Sequence MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Involvement in Disease Ischemic stroke (ISCHSTR)
Subcellular Location Nucleus membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families MAPEG family
Tissue Specificity ALOX5AP
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$1,641.00
In stock
SKU
EB-PC5HU1750

Recombinant Human Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)
Copyright © 2021-present Echo Biosystems. All rights reserved.