Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P29972 |
| Gene Names | AQP1 |
| Alternative Names | Aquaporin-CHIPUrine water channelWater channel protein for red blood cells and kidney proximal tubule |
| Expression Region | Partial(220-269aa ) |
| Molecular Weight | 32.6 kDa |
| Protein Sequence | GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Forms a water-specific channel that provides the plasma mbranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | MIP/aquaporin (TC 1.A.8) family |
| Tissue Specificity | AQP1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
