Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P02654 |
Gene Names | APOC1 |
Alternative Names | Apolipoprotein C1 (Apo-CI) (ApoC-I) |
Expression Region | Full Length of Mature Protein(27-83aa ) |
Molecular Weight | 22.6 kDa |
Protein Sequence | TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Inhibitor of lipoprotein binding to the low density lipoprotein receptor, LDL receptor-related protein, and very low density lipoprotein receptor. Associates with high density lipoproteins and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein. Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | APOC1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |