Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P04114 |
| Gene Names | APOB |
| Alternative Names | Apo B-100 (Apo B-48) |
| Expression Region | Partial(28-127aa ) |
| Molecular Weight | 14.7 kDa |
| Protein Sequence | EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor. |
| Involvement in Disease | Hypobetalipoproteinemia, familial, 1 (FHBL1); Familial ligand-defective apolipoprotein B-100 (FDB) |
| Subcellular Location | Cytoplasm, Secreted |
| Protein Families | |
| Tissue Specificity | APOB |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |