Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens apolipoprotein A2 (APOA2) (NM_001643). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P02652 |
| Entry Name | APOA2_HUMAN |
| Gene Names | APOA2 |
| Alternative Gene Names | |
| Alternative Protein Names | Apolipoprotein A-II (Apo-AII) (ApoA-II) (Apolipoprotein A2) [Cleaved into: Proapolipoprotein A-II (ProapoA-II); Truncated apolipoprotein A-II (Apolipoprotein A-II(1-76))] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 100 |
| Molecular Weight(Da) | 11175 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ |
Background
| Function | FUNCTION: May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. |
| Pathway | |
| Protein Families | Apolipoprotein A2 family |
| Tissue Specificity | Plasma; synthesized in the liver and intestine. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |