Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q6UXH0 |
| Gene Names | C19orf80 |
| Alternative Names | Betatrophin1 |
| Expression Region | Full Length of Mature Protein(22-198aa ) |
| Molecular Weight | 23.9 kDa |
| Protein Sequence | APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels . May be involved in the metabolic transition between fasting and refeeding: required to direct fatty acids to adipose tissue for storage in the fed state . |
| Involvement in Disease | Diabetes mellitus, insulin-dependent (IDDM); Diabetes mellitus, non-insulin-dependent (NIDDM) |
| Subcellular Location | Secreted |
| Protein Families | ANGPTL8 family |
| Tissue Specificity | C19orf80 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |