Recombinant Human Androgen-dependent TFPI-regulating protein(ADTRP)

Specification
Organism Homo sapiens (Human)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q96IZ2
Gene Names ADTRP
Alternative Names C6orf105
Expression Region Full Length(1-230aa )
Molecular Weight 31.8 kDa
Protein Sequence MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells
Involvement in Disease
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families AIG1 family
Tissue Specificity ADTRP
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$1,739.00
In stock
SKU
EB-PCUb18466526

Recombinant Human Androgen-dependent TFPI-regulating protein(ADTRP)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Androgen-dependent TFPI-regulating protein(ADTRP)
Copyright © 2021-present Echo Biosystems. All rights reserved.