Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q99217 |
| Gene Names | AMELX |
| Alternative Names | AI1E; AIH1; ALGN; Amel; Amelogenesis imperfecta 1; Amelogenin (amelogenesis imperfecta 1; X linked); Amelogenin (X chromosome); Amelogenin (X chromosome; amelogenesis imperfecta 1); Amelogenin; Amelogenin X isoform; Amelogenin; X linked; AMELX; AMELX_HUMAN; Amg; AMGL; AMGX; OTTHUMP00000022906; OTTHUMP00000022907; X isoform |
| Expression Region | Full Length of Mature Protein(17-191aa ) |
| Molecular Weight | 35.9 kDa |
| Protein Sequence | MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel. |
| Involvement in Disease | Amelogenesis imperfecta 1E (AI1E) |
| Subcellular Location | Secreted, extracellular space, extracellular matrix |
| Protein Families | Amelogenin family |
| Tissue Specificity | AMELX |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
