Recombinant Human Amelogenin, X isoform(AMELX)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q99217
Gene Names AMELX
Alternative Names AI1E; AIH1; ALGN; Amel; Amelogenesis imperfecta 1; Amelogenin (amelogenesis imperfecta 1; X linked); Amelogenin (X chromosome); Amelogenin (X chromosome; amelogenesis imperfecta 1); Amelogenin; Amelogenin X isoform; Amelogenin; X linked; AMELX; AMELX_HUMAN; Amg; AMGL; AMGX; OTTHUMP00000022906; OTTHUMP00000022907; X isoform
Expression Region Full Length of Mature Protein(17-191aa )
Molecular Weight 35.9 kDa
Protein Sequence MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.
Involvement in Disease Amelogenesis imperfecta 1E (AI1E)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Amelogenin family
Tissue Specificity AMELX
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE3HU860878

Recombinant Human Amelogenin, X isoform(AMELX)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Amelogenin, X isoform(AMELX)
Copyright © 2021-present Echo Biosystems. All rights reserved.