Recombinant Human ALKBH6 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens alkB homolog 6 (ALKBH6), transcript variant 1 (NM_198867).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q3KRA9
Entry Name ALKB6_HUMAN
Gene Names ALKBH6 ABH6
Alternative Gene Names ABH6
Alternative Protein Names Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6 (EC 1.14.11.-) (Alkylated DNA repair protein alkB homolog 6)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 238
Molecular Weight(Da) 26483
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTISLGSHTVLDFYEPRRPEDDDPTEQPRPPPRPTTSLLLEPRSLLVLRGPAYTRLLHGIAAARVDALDAASSPPNAAACPSARPGACLVRGTRVSLTIRRVPRVLRAGLLLGK
Background
Function FUNCTION: Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron. {ECO:0000250}.
Pathway
Protein Families AlkB family
Tissue Specificity Widely expressed, with highest expression in testis and pancreas. {ECO:0000269|PubMed:17979886}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8210656

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human ALKBH6 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.