Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P52895 |
| Gene Names | AKR1C2 |
| Alternative Names | 3-alpha-HSD;3Chlordecone reductase homolog HAKRD;Dihydrodiol dehydrogenase 2 ;DD-2 ;DD2Dihydrodiol dehydrogenase/bile acid-binding protein ;DD/BABPTrans-1,2-dihydrobenzene-1,2-diol dehydrogenase (EC:1.3.1.20);Type III 3-alpha-hydroxysteroid dehydrogenase (EC:1.1.1.357) |
| Expression Region | Full Length(1-323aa ) |
| Molecular Weight | 52.7 kDa |
| Protein Sequence | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Has a high bile-binding ability. |
| Involvement in Disease | 46,XY sex reversal 8 (SRXY8) |
| Subcellular Location | Cytoplasm |
| Protein Families | Aldo/keto reductase family |
| Tissue Specificity | AKR1C2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |